SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g30770

Feature Type:gene_model
Chromosome:Gm19
Start:38419691
stop:38422649
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g30770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G12250AT Annotation by Michelle Graham. TAIR10: beta-6 tubulin | chr5:3961317-3962971 REVERSE LENGTH=449 SoyBaseE_val: 0ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0007017GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based process SoyBaseN/AISS
GO:0007018GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based movement SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051258GO-bp Annotation by Michelle Graham. GO Biological Process: protein polymerization SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005874GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0015630GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule cytoskeleton SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0005200GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG1375 KOG Beta tubulin JGI ISS
PTHR11588Panther TUBULIN JGI ISS
PF00091PFAM Tubulin/FtsZ family, GTPase domain JGI ISS
PF03953PFAM Tubulin C-terminal domain JGI ISS
UniRef100_G7L5U9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Tubulin beta chain n=3 Tax=core eudicotyledons RepID=G7L5U9_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1N8P5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N8P5_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma19g30770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g30770
ParalogEvidenceComments
Glyma03g27970 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g30770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g127700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g30770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g30770
>Glyma19g30770.1   sequence type=CDS   gene model=Glyma19g30770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGGAGATCCTTCACGTGCAGGGAGGGCAATGCGGGAACCAGATCGGTTCCAAGTTCTGGGAAGTGGTGTGCGACGAGCACGGCATAGATCCGACGGGGAAGTACGTCGGAAACTCAGATCTGCAACTCGAGCGCGTGAACGTCTACTACAATGAAGCCTCGTGCGGGCGCTTCGTGCCACGCGCGGTGCTGATGGACCTGGAGCCCGGAACCATGGACAGCGTGCGGACCGGGCCGTACGGGCAGATCTTCCGCCCCGACAACTTCGTGTTCGGGCAGTCCGGCGCCGGCAACAACTGGGCTAAGGGGCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTCCTCGACGTCGTGCGTAAGGAGGCCGAGAACTGCGACTGCCTCCAGGGGTTCCAGGTCTGCCACTCGCTCGGCGGCGGAACGGGCTCCGGGATGGGGACGCTTCTTATTTCCAAGATCAGAGAGGAGTATCCTGACAGGATGATGCTTACTTTCTCCGTTTTTCCTTCGCCCAAGGTCTCCGACACTGTTGTTGAGCCTTATAACGCTACTCTCTCTGTTCACCAGTTGGTGGAGAATGCTGATGAGTGTATGGTGCTGGATAATGAGGCGCTCTACGATATCTGCTTCAGGACTCTCAAGTTGACCACTCCTAGCTTTGGTGACTTGAATCACTTGATCTCCGCAACCATGAGTGGTGTTACATGCTGTCTTCGTTTCCCTGGTCAACTCAACTCTGATCTGAGGAAACTGGCCGTGAATCTCATCCCTTTCCCTCGTCTGCACTTCTTCATGGTTGGATTTGCGCCTCTCACCTCTCGTGGCTCTCAGCAGTACCGTGCATTGACAGTTCCAGAGCTGACACAGCAAATGTGGGATGCCAAGAATATGATGTGTGCCGCTGATCCCAGGCACGGGCGTTACCTCACGGCATCAGCCATGTTCCGTGGCAAGATGAGCACGAAGGAGGTGGATGAGCAGATGATAAACGTGCAGAACAAAAACTCTTCGTACTTTGTCGAGTGGATTCCCAACAATGTCAAGTCGAGTGTGTGTGACATTGCTCCTAGAGGGCTCTCCATGGCGTCCACATTCATTGGAAACTCGACCTCGATTCAGGAGATGTTCAGGAGGGTGAGCGAGCAGTTCACGGCCATGTTTAGGAGGAAGGCTTTCTTGCATTGGTACACTGGTGAAGGCATGGACGAGATGGAGTTCACGGAGGCAGAGAGCAACATGAATGACCTTGTGTCTGAGTACCAGCAGTACCAGGACGCCACTGCTGAGGACGAAGGGGAGTACGAGGATGAGGAGGAAGAGGATGGTGAAGCAGACGACCATATGTGA
Predicted protein sequences of Glyma19g30770
>Glyma19g30770.1   sequence type=predicted peptide   gene model=Glyma19g30770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGNSDLQLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIAPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEDEGEYEDEEEEDGEADDHM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo